EPAG_HUMAN Q14236
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q14236
Recommended name：Early lymphoid activation gene protein
EC number：
Alternative names：(DIAPH2 antisense RNA 1) (DIAPH2 antisense gene protein 1)
Cleaved into：
GeneID：
Gene names (primary )：DIAPH2-AS1
Gene names (synonym )：EPAG
Gene names (ORF )：
Length：149
Mass：17843
Sequence：MNLYLHPKLWPQLAGTKTLHVADAQRVRKITVHDGIWDAELPRAKRNHSYHLRYHGSSYSRCFLERYRCKTIGVFRRSNQPDCLETRSEKAKNRDGVVQEKSVRTLFSECVNQCDIRRRPTRFLRMFYHQKHFQLGLKGTETEKNERRL
Tissue specificity：Expressed in heart, kidney, lung, and skeletal muscle, with lower levels in pancreas and liver. {ECO:0000269|PubMed:8133036}.
Induction：
Developmental stage：
Protein families：