DPH3B_HUMAN   Q9H4G8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H4G8

Recommended name:Putative DPH3 homolog B

EC number:

Alternative names:(CSL-type zinc finger-containing protein 1)

Cleaved into:

GeneID:100132911

Gene names  (primary ):DPH3P1

Gene names  (synonym ):C20orf143 DPH3B ZCSL1

Gene names  (ORF ):

Length:78

Mass:8721

Sequence:MAVFHDEVEIEDFQYDEDSETYFCPCPCGDNFSITKEELENGEGVAMCPGCSLIIKVIYDKDQFACGETVPVPSVNKE

Tissue specificity:

Induction:

Developmental stage:

Protein families:DPH3 family


   💬 WhatsApp