TDGF1_HUMAN   P13385


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P13385

Recommended name:Teratocarcinoma-derived growth factor 1

EC number:

Alternative names:(Cripto-1 growth factor) (CRGF) (Epidermal growth factor-like cripto protein CR1)

Cleaved into:

GeneID:6997

Gene names  (primary ):TDGF1

Gene names  (synonym ):CRIPTO

Gene names  (ORF ):

Length:188

Mass:21169

Sequence:MDCRKMARFSYSVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSYY

Tissue specificity:Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts. Expressed in breast and lung. {ECO:0000269|PubMed:18835250}.

Induction:

Developmental stage:

Protein families:EGF-CFC (Cripto-1/FRL1/Cryptic) family


   💬 WhatsApp