QCR7_HUMAN   P14927


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P14927

Recommended name:Cytochrome b-c1 complex subunit 7

EC number:

Alternative names:(Complex III subunit 7) (Complex III subunit VII) (QP-C) (Ubiquinol-cytochrome c reductase complex 14 kDa protein)

Cleaved into:

GeneID:7381

Gene names  (primary ):UQCRB

Gene names  (synonym ):UQBP

Gene names  (ORF ):

Length:111

Mass:13530

Sequence:MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK

Tissue specificity:

Induction:

Developmental stage:

Protein families:UQCRB/QCR7 family


   💬 WhatsApp