C1QT3_HUMAN Q9BXJ4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BXJ4
Recommended name：Complement C1q tumor necrosis factor-related protein 3
EC number：
Alternative names：(Collagenous repeat-containing sequence 26 kDa protein) (CORS26) (Secretory protein CORS26)
Cleaved into：
GeneID：114899
Gene names (primary )：C1QTNF3
Gene names (synonym )：CTRP3
Gene names (ORF )：UNQ753/PRO1484
Length：246
Mass：26994
Sequence：MLWRQLIYWQLLALFFLPFCLCQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
Tissue specificity：Expressed in colon and small intestine. {ECO:0000269|PubMed:14654242}.
Induction：
Developmental stage：
Protein families：