TXTP_HUMAN   P53007


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P53007

Recommended name:Tricarboxylate transport protein, mitochondrial

EC number:

Alternative names:(Citrate transport protein) (CTP) (Solute carrier family 25 member 1) (Tricarboxylate carrier protein)

Cleaved into:

GeneID:6576

Gene names  (primary ):SLC25A1

Gene names  (synonym ):SLC20A3

Gene names  (ORF ):

Length:311

Mass:34013

Sequence:MPAPRAPRALAAAAPASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLLNKVWKTD

Tissue specificity:

Induction:

Developmental stage:

Protein families:Mitochondrial carrier (TC 2.A.29) family


   💬 WhatsApp