FLTOP_HUMAN   Q5VTH2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5VTH2

Recommended name:Protein Flattop

EC number:

Alternative names:(Cilia- and flagella-associated protein 126)

Cleaved into:

GeneID:257177

Gene names  (primary ):CFAP126

Gene names  (synonym ):C1orf192 FLTP

Gene names  (ORF ):

Length:177

Mass:19293

Sequence:MATNYSANQYEKAFSSKYLQNWSPTKPTKESISSHEGYTQIIANDRGHLLPSVPRSKANPWGSFMGTWQMPLKIPPARVTLTSRTTAGAASLTKWIQKNPDLLKASNGLCPEILGKPHDPDSQKKLRKKSITKTVQQARSPTIIPSSPAANLNSPDELQSSHPSAGHTPGPQRPAKS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Flattop family


   💬 WhatsApp