PPL13_HUMAN   Q8TCE9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8TCE9

Recommended name:Placental protein 13-like

EC number:

Alternative names:(Charcot-Leyden crystal protein 2) (CLC2) (Galectin-14) (Gal-14)

Cleaved into:

GeneID:56891

Gene names  (primary ):LGALS14

Gene names  (synonym ):PPL13

Gene names  (ORF ):

Length:139

Mass:16094

Sequence:MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD

Tissue specificity:Highly expressed in placenta. {ECO:0000269|PubMed:11997112, ECO:0000269|PubMed:19497882}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp