RET5_HUMAN P82980
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P82980
Recommended name：Retinol-binding protein 5
EC number：
Alternative names：(Cellular retinol-binding protein III) (CRBP-III) (HRBPiso)
Cleaved into：
GeneID：83758
Gene names (primary )：RBP5
Gene names (synonym )：
Gene names (ORF )：
Length：135
Mass：15931
Sequence：MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR
Tissue specificity：Higher expression in adult kidney and liver and to a lesser extent in adult and fetal spleen, adult lymph nodes and appendix, and fetal liver and kidney. Strongly decreased in hepatocellular carcinoma tissues (at protein level). {ECO:0000269|PubMed:11274389, ECO:0000269|PubMed:17497168}.
Induction：
Developmental stage：
Protein families：Calycin superfamily, Fatty-acid binding protein (FABP) family