CD53_HUMAN P19397
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P19397
Recommended name：Leukocyte surface antigen CD53
EC number：
Alternative names：(Cell surface glycoprotein CD53) (Tetraspanin-25) (Tspan-25) (CD antigen CD53)
Cleaved into：
GeneID：963
Gene names (primary )：CD53
Gene names (synonym )：MOX44 TSPAN25
Gene names (ORF )：
Length：219
Mass：24341
Sequence：MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL
Tissue specificity：B-cells, monocytes, macrophages, neutrophils, single (CD4 or CD8) positive thymocytes and peripheral T-cells.
Induction：
Developmental stage：
Protein families：Tetraspanin (TM4SF) family