CCL27_HUMAN   Q9Y4X3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y4X3

Recommended name:C-C motif chemokine 27

EC number:

Alternative names:(CC chemokine ILC) (Cutaneous T-cell-attracting chemokine) (CTACK) (ESkine) (IL-11 R-alpha-locus chemokine) (Skinkine) (Small-inducible cytokine A27)

Cleaved into:

GeneID:10850

Gene names  (primary ):CCL27

Gene names  (synonym ):ILC SCYA27

Gene names  (ORF ):

Length:112

Mass:12618

Sequence:MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG

Tissue specificity:Testis, thymus, placenta, ovary and skin.

Induction:

Developmental stage:

Protein families:Intercrine beta (chemokine CC) family


   💬 WhatsApp