IFM5_HUMAN   A6NNB3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A6NNB3

Recommended name:Interferon-induced transmembrane protein 5

EC number:

Alternative names:(Bone-restricted interferon-induced transmembrane protein-like protein) (BRIL) (Dispanin subfamily A member 1) (DSPA1)

Cleaved into:

GeneID:387733

Gene names  (primary ):IFITM5

Gene names  (synonym ):

Gene names  (ORF ):

Length:132

Mass:14378

Sequence:MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYSIKARDQKVVGDLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAAFFSTKFDDADYD

Tissue specificity:Detected in bone (PubMed:24058703). Detected in osteoblasts and fibroblasts (at protein level) (PubMed:24519609). Detected in bone (PubMed:24058703). Detected in osteoblasts and fibroblasts (PubMed:24519609). {ECO:0000269|PubMed:24058703, ECO:0000269|PubMed:24519609}.

Induction:

Developmental stage:

Protein families:CD225/Dispanin family


   💬 WhatsApp