DB126_HUMAN   Q9BYW3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BYW3

Recommended name:Beta-defensin 126

EC number:

Alternative names:(Beta-defensin 26) (DEFB-26) (Defensin, beta 126) (Epididymal secretory protein 13.2) (ESP13.2) (HBD26)

Cleaved into:

GeneID:81623

Gene names  (primary ):DEFB126

Gene names  (synonym ):C20orf8 DEFB26

Gene names  (ORF ):

Length:111

Mass:12174

Sequence:MKSLLFTLAVFMLLAQLVSGNWYVKKCLNDVGICKKKCKPEEMHVKNGWAMCGKQRDCCVPADRRANYPVFCVQTKTTRISTVTATTATTTLMMTTASMSSMAPTPVSPTG

Tissue specificity:High-level and epididymis-specific expression. Expression is down-regulated in infertile men. {ECO:0000269|PubMed:17928628}.

Induction:

Developmental stage:

Protein families:Beta-defensin family


   💬 WhatsApp