DB126_HUMAN Q9BYW3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BYW3
Recommended name：Beta-defensin 126
EC number：
Alternative names：(Beta-defensin 26) (DEFB-26) (Defensin, beta 126) (Epididymal secretory protein 13.2) (ESP13.2) (HBD26)
Cleaved into：
GeneID：81623
Gene names (primary )：DEFB126
Gene names (synonym )：C20orf8 DEFB26
Gene names (ORF )：
Length：111
Mass：12174
Sequence：MKSLLFTLAVFMLLAQLVSGNWYVKKCLNDVGICKKKCKPEEMHVKNGWAMCGKQRDCCVPADRRANYPVFCVQTKTTRISTVTATTATTTLMMTTASMSSMAPTPVSPTG
Tissue specificity：High-level and epididymis-specific expression. Expression is down-regulated in infertile men. {ECO:0000269|PubMed:17928628}.
Induction：
Developmental stage：
Protein families：Beta-defensin family