DB110_HUMAN   Q30KQ9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q30KQ9

Recommended name:Beta-defensin 110

EC number:

Alternative names:(Beta-defensin 10) (DEFB-10) (Beta-defensin 11) (DEFB-11) (Beta-defensin 111) (Defensin, beta 110) (Defensin, beta 111)

Cleaved into:

GeneID:245913

Gene names  (primary ):DEFB110

Gene names  (synonym ):DEFB10 DEFB11 DEFB111

Gene names  (ORF ):

Length:67

Mass:8001

Sequence:MKIQLFFFILHFWVTILPAKKKYPEYGSLDLRRECRIGNGQCKNQCHENEIRIAYCIRPGTHCCLQQ

Tissue specificity:

Induction:

Developmental stage:

Protein families:Beta-defensin family


   💬 WhatsApp