DLX4_HUMAN Q92988
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q92988
Recommended name：Homeobox protein DLX-4
EC number：
Alternative names：(Beta protein 1) (Homeobox protein DLX-7) (Homeobox protein DLX-8)
Cleaved into：
GeneID：1748
Gene names (primary )：DLX4
Gene names (synonym )：BP1 DLX7 DLX8 DLX9
Gene names (ORF )：
Length：240
Mass：26263
Sequence：MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM
Tissue specificity：Expressed in leukemia cells and placenta. Also expressed in kidney and fetal liver. {ECO:0000269|PubMed:11069021, ECO:0000269|PubMed:11909945}.
Induction：
Developmental stage：
Protein families：Distal-less homeobox family