MLP3B_HUMAN Q9GZQ8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9GZQ8
Recommended name：Microtubule-associated proteins 1A/1B light chain 3B
EC number：
Alternative names：(Autophagy-related protein LC3 B) (Autophagy-related ubiquitin-like modifier LC3 B) (MAP1 light chain 3-like protein 2) (MAP1A/MAP1B light chain 3 B) (MAP1A/MAP1B LC3 B) (Microtubule-associated protein 1 light chain 3 beta)
Cleaved into：
GeneID：81631
Gene names (primary )：MAP1LC3B
Gene names (synonym )：MAP1ALC3
Gene names (ORF )：
Length：125
Mass：14688
Sequence：MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV
Tissue specificity：Most abundant in heart, brain, skeletal muscle and testis. Little expression observed in liver. {ECO:0000269|PubMed:12740394}.
Induction：
Developmental stage：
Protein families：ATG8 family