LYPA2_HUMAN   O95372


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O95372

Recommended name:Acyl-protein thioesterase 2

EC number:EC:3.1.2.-

Alternative names:(APT-2) (Lysophospholipase II) (LPL-II) (LysoPLA II)

Cleaved into:

GeneID:11313

Gene names  (primary ):LYPLA2

Gene names  (synonym ):APT2

Gene names  (ORF ):

Length:231

Mass:24737

Sequence:MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV

Tissue specificity:Expressed in various breast cancer cell lines. {ECO:0000269|PubMed:25301951}.

Induction:

Developmental stage:

Protein families:AB hydrolase superfamily, AB hydrolase 2 family