AP5S1_HUMAN   Q9NUS5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NUS5

Recommended name:AP-5 complex subunit sigma-1

EC number:

Alternative names:(Adaptor-related protein complex 5 sigma subunit) (Sigma5)

Cleaved into:

GeneID:55317

Gene names  (primary ):AP5S1

Gene names  (synonym ):C20orf29

Gene names  (ORF ):

Length:200

Mass:22522

Sequence:MVHAFLIHTLRAPNTEDTGLCRVLYSCVFGAEKSPDDPRPHGAERDRLLRKEQILAVARQVESMCRLQQQASGRPPMDLQPQSSDEQVPLHEAPRGAFRLAAENPFQEPRTVVWLGVLSLGFALVLDAHENLLLAEGTLRLLTRLLLDHLRLLAPSTSLLLRADRIEGILTRFLPHGQLLFLNDQFVQGLEKEFSAAWPR

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp