NDUAC_HUMAN   Q9UI09


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UI09

Recommended name:NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

EC number:

Alternative names:(13 kDa differentiation-associated protein) (Complex I-B17.2) (CI-B17.2) (CIB17.2) (NADH-ubiquinone oxidoreductase subunit B17.2)

Cleaved into:

GeneID:55967

Gene names  (primary ):NDUFA12

Gene names  (synonym ):DAP13

Gene names  (ORF ):

Length:145

Mass:17114

Sequence:MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK

Tissue specificity:

Induction:

Developmental stage:

Protein families:Complex I NDUFA12 subunit family


   💬 WhatsApp