CD99_HUMAN P14209
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P14209
Recommended name：CD99 antigen
EC number：
Alternative names：(12E7) (E2 antigen) (Protein MIC2) (T-cell surface glycoprotein E2)
Cleaved into：
GeneID：4267
Gene names (primary )：CD99
Gene names (synonym )：MIC2 MIC2X MIC2Y
Gene names (ORF )：
Length：185
Mass：18848
Sequence：MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK
Tissue specificity：
Induction：
Developmental stage：
Protein families：CD99 family