UBCP1_HUMAN Q8WVY7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8WVY7
Recommended name：Ubiquitin-like domain-containing CTD phosphatase 1
EC number：EC:3.1.3.16
Alternative names：(Nuclear proteasome inhibitor UBLCP1)
Cleaved into：
GeneID：134510
Gene names (primary )：UBLCP1
Gene names (synonym )：
Gene names (ORF )：
Length：318
Mass：36805
Sequence：MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREESLEDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPREGKKLLVLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVHTPRRGLIDVKPLGVIWGKFSEFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDKDKELLKLTQYLKEIAKLDDFLDLNHKYWERYLSKKQGQ
Tissue specificity：Broadly expressed, with highest levels in placenta, lung, testis and ovary. Up-regulated in tumor tissues. {ECO:0000269|PubMed:15883030}.
Induction：
Developmental stage：
Protein families：