EFMT1_HUMAN   Q8WVE0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8WVE0

Recommended name:EEF1A lysine methyltransferase 1

EC number:EC:2.1.1.-

Alternative names:(N(6)-adenine-specific DNA methyltransferase 2) (Protein-lysine N-methyltransferase N6AMT2)

Cleaved into:

GeneID:221143

Gene names  (primary ):EEF1AKMT1

Gene names  (synonym ):N6AMT2

Gene names  (ORF ):

Length:214

Mass:24506

Sequence:MSDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAAVGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGLDCGI

Tissue specificity:

Induction:

Developmental stage:

Protein families:Class I-like SAM-binding methyltransferase superfamily, EFM5 family


   💬 WhatsApp