GRAM_HUMAN   P51124


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P51124

Recommended name:Granzyme M

EC number:EC:3.4.21.-

Alternative names:(Met-1 serine protease) (Hu-Met-1) (Met-ase) (Natural killer cell granular protease)

Cleaved into:

GeneID:3004

Gene names  (primary ):GZMM

Gene names  (synonym ):MET1

Gene names  (ORF ):

Length:257

Mass:27545

Sequence:MEACVSSLLVLALGALSVGSSFGTQIIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLARVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRSA

Tissue specificity:Highly and constitutively expressed in activated natural killer (NK) cells. {ECO:0000269|PubMed:18523284}.

Induction:

Developmental stage:

Protein families:Peptidase S1 family, Granzyme subfamily


   💬 WhatsApp