KLK5_HUMAN Q9Y337
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Y337
Recommended name:Kallikrein-5
EC number:EC:3.4.21.-
Alternative names:(Kallikrein-like protein 2) (KLK-L2) (Stratum corneum tryptic enzyme)
Cleaved into:
GeneID:25818
Gene names (primary ):KLK5
Gene names (synonym ):SCTE
Gene names (ORF ):UNQ570/PRO1132
Length:293
Mass:32020
Sequence:MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Tissue specificity:Expressed in skin, breast, brain and testis. Expressed at the stratum granulosum of palmar skin. {ECO:0000269|PubMed:19190773}.
Induction:
Developmental stage:
Protein families:Peptidase S1 family, Kallikrein subfamily