HARB1_HUMAN   Q96MB7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96MB7

Recommended name:Putative nuclease HARBI1

EC number:EC:3.1.-.-

Alternative names:(Harbinger transposase-derived nuclease)

Cleaved into:

GeneID:283254

Gene names  (primary ):HARBI1

Gene names  (synonym ):C11orf77

Gene names  (ORF ):

Length:349

Mass:39146

Sequence:MAIPITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYYLVELLGANLSRPTQRSRAISPETQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIRFPADEASIQALKDEFYGLAGMPGVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSVIEKTFRTLCSRFRCLDGSKGALQYSPEKSSHIILACCVLHNISLEHGMDVWSSPMTGPMEQPPEEEYEHMESLDLEADRIRQELMLTHFS

Tissue specificity:Detected in brain, eye, nerve tissue, kidney and lung. {ECO:0000269|PubMed:15169610}.

Induction:

Developmental stage:

Protein families:HARBI1 family


   💬 WhatsApp