GSTM2_HUMAN   P28161


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P28161

Recommended name:Glutathione S-transferase Mu 2

EC number:EC:2.5.1.18

Alternative names:(GST class-mu 2) (GSTM2-2)

Cleaved into:

GeneID:2946

Gene names  (primary ):GSTM2

Gene names  (synonym ):GST4

Gene names  (ORF ):

Length:218

Mass:25745

Sequence:MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK

Tissue specificity:Muscle.

Induction:

Developmental stage:

Protein families:GST superfamily, Mu family


   💬 WhatsApp