CDC42_HUMAN P60953
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P60953
Recommended name:Cell division control protein 42 homolog
EC number:EC:3.6.5.2
Alternative names:(G25K GTP-binding protein)
Cleaved into:
GeneID:998
Gene names (primary ):CDC42
Gene names (synonym ):
Gene names (ORF ):
Length:191
Mass:21259
Sequence:MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Tissue specificity:
Induction:
Developmental stage:
Protein families:Small GTPase superfamily, Rho family, CDC42 subfamily