MPPD2_HUMAN   Q15777


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q15777

Recommended name:Metallophosphoesterase MPPED2

EC number:EC:3.1.-.-

Alternative names:(Fetal brain protein 239) (239FB) (Metallophosphoesterase domain-containing protein 2)

Cleaved into:

GeneID:744

Gene names  (primary ):MPPED2

Gene names  (synonym ):C11orf8 FAM1B

Gene names  (ORF ):

Length:294

Mass:33360

Sequence:MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS

Tissue specificity:Expressed predominantly in fetal brain.

Induction:

Developmental stage:

Protein families:UPF0046 family


   💬 WhatsApp