DHRSX_HUMAN Q8N5I4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8N5I4
Recommended name：Dehydrogenase/reductase SDR family member on chromosome X
EC number：
Alternative names：(DHRSXY) (Short chain dehydrogenase/reductase family 46C member 1) (Short chain dehydrogenase/reductase family 7C member 6)
Cleaved into：
GeneID：207063
Gene names (primary )：DHRSX
Gene names (synonym )：CXorf11 DHRS5X SDR46C1 SDR7C6
Gene names (ORF )：UNQ6508/PRO21433
Length：330
Mass：36443
Sequence：MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDVYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYAAVTPELEGVGGHYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTL
Tissue specificity：Widely expressed. Highly expressed in the pancreas. {ECO:0000269|PubMed:11731500, ECO:0000269|PubMed:25076851}.
Induction：
Developmental stage：
Protein families：Short-chain dehydrogenases/reductases (SDR) family