ATG4C_HUMAN   Q96DT6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96DT6

Recommended name:Cysteine protease ATG4C

EC number:EC:3.4.22.-

Alternative names:(AUT-like 3 cysteine endopeptidase) (Autophagin-3) (Autophagy-related cysteine endopeptidase 3) (Autophagy-related protein 4 homolog C)

Cleaved into:

GeneID:84938

Gene names  (primary ):ATG4C

Gene names  (synonym ):APG4C AUTL1 AUTL3

Gene names  (ORF ):

Length:458

Mass:52497

Sequence:MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALNIENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMTSDNADDKAVIILVPVRLGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFKRASEEITKMLKFSSKEKYPLFTFVNGHSRDYDFTSTTTNEEDLFSEDEKKQLKRFSTEEFVLL

Tissue specificity:Highly expressed in skeletal muscle, heart, liver and testis. {ECO:0000269|PubMed:12446702}.

Induction:

Developmental stage:

Protein families:Peptidase C54 family


   💬 WhatsApp