ATG4B_HUMAN   Q9Y4P1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y4P1

Recommended name:Cysteine protease ATG4B

EC number:EC:3.4.22.-

Alternative names:(AUT-like 1 cysteine endopeptidase) (Autophagin-1) (Autophagy-related cysteine endopeptidase 1) (Autophagy-related protein 4 homolog B) (hAPG4B)

Cleaved into:

GeneID:23192

Gene names  (primary ):ATG4B

Gene names  (synonym ):APG4B AUTL1 KIAA0943

Gene names  (ORF ):

Length:393

Mass:44294

Sequence:MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL

Tissue specificity:Mainly expressed in the skeletal muscle, followed by brain, heart, liver and pancreas. {ECO:0000269|PubMed:12446702, ECO:0000269|PubMed:15169837}.

Induction:

Developmental stage:

Protein families:Peptidase C54 family


   💬 WhatsApp