ARK74_HUMAN   Q8NHP1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8NHP1

Recommended name:Aflatoxin B1 aldehyde reductase member 4

EC number:

Alternative names:(AFB1 aldehyde reductase 3) (AFB1-AR 3) (Aldoketoreductase 7-like)

Cleaved into:

GeneID:246181

Gene names  (primary ):AKR7L

Gene names  (synonym ):AFAR3 AKR7A4

Gene names  (ORF ):

Length:331

Mass:36970

Sequence:MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFLYSDGQSETILGGLGLRMGSSDCRVKIATKANPWIGNSLKPDSVRSQLETSLKRLQCPRVDLFYLHAPDHSAPVEETLRACHQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQGMYSATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGTQWAEIYRNHFWKEHHFEGIALVEKALQAAYGASAPSMTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAAAEEGPLEPAVVDAFNQAWHLFAHECPNYFI

Tissue specificity:Mainly expressed in uterus. {ECO:0000269|PubMed:12879023}.

Induction:

Developmental stage:

Protein families:Aldo/keto reductase family, Aldo/keto reductase 2 subfamily