ARK73_HUMAN O95154
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O95154
Recommended name：Aflatoxin B1 aldehyde reductase member 3
EC number：
Alternative names：(AFB1 aldehyde reductase 2) (AFB1-AR 2)
Cleaved into：
GeneID：22977
Gene names (primary )：AKR7A3
Gene names (synonym )：AFAR2
Gene names (ORF )：
Length：331
Mass：37206
Sequence：MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSETILGGLGLRLGGSDCRVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVEETLRACHQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTWAEMYRNRYWKEHHFEGIALVEKALQAAYGASAPSMTSATLRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAAAEEGPLEPAVVDAFNQAWHLVTHECPNYFR
Tissue specificity：Expressed in colon, kidney, liver, pancreas, adenocarcinoma and endometrium. {ECO:0000269|PubMed:12879023, ECO:0000269|PubMed:18416522}.
Induction：
Developmental stage：
Protein families：Aldo/keto reductase family, Aldo/keto reductase 2 subfamily