LGAT1_HUMAN   Q92604


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q92604

Recommended name:Acyl-CoA:lysophosphatidylglycerol acyltransferase 1

EC number:EC:2.3.1.-

Alternative names:(Acyl-CoA:monoacylglycerol acyltransferase LPGAT1)

Cleaved into:

GeneID:9926

Gene names  (primary ):LPGAT1

Gene names  (synonym ):FAM34A KIAA0205

Gene names  (ORF ):

Length:370

Mass:43089

Sequence:MAITLEEAPWLGWLLVKALMRFAFMVVNNLVAIPSYICYVIILQPLRVLDSKRFWYIEGIMYKWLLGMVASWGWYAGYTVMEWGEDIKAVSKDEAVMLVNHQATGDVCTLMMCLQDKGLVVAQMMWLMDHIFKYTNFGIVSLVHGDFFIRQGRSYRDQQLLLLKKHLENNYRSRDRKWIVLFPEGGFLRKRRETSQAFAKKNNLPFLTNVTLPRSGATKIILNALVAQQKNGSPAGGDAKELDSKSKGLQWIIDTTIAYPKAEPIDIQTWILGYRKPTVTHVHYRIFPIKDVPLETDDLTTWLYQRFVEKEDLLSHFYETGAFPPSKGHKEAVSREMTLSNLWIFLIQSFAFLSGYMWYNIIQYFYHCLF

Tissue specificity:Highly expressed in liver and placenta. Also expressed in peripheral blood, lung, kidney and brain. Detected at lower levels in colon. {ECO:0000269|PubMed:15485873}.

Induction:

Developmental stage:

Protein families:1-acyl-sn-glycerol-3-phosphate acyltransferase family


   💬 WhatsApp