DHI1L_HUMAN Q7Z5J1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7Z5J1
Recommended name：Hydroxysteroid 11-beta-dehydrogenase 1-like protein
EC number：EC:1.1.1.-
Alternative names：(11-beta-hydroxysteroid dehydrogenase type 3) (11-DH3) (11-beta-HSD3) (Short chain dehydrogenase/reductase family 26C member 2) (Short-chain dehydrogenase/reductase 10)
Cleaved into：
GeneID：374875
Gene names (primary )：HSD11B1L
Gene names (synonym )：HSD3 SCDR10 SDR26C2
Gene names (ORF )：
Length：315
Mass：34288
Sequence：MKVLLLTGLGALFFAYYWDDNFDPASLQGARVLLTGANAGVGEELAYHYARLGSHLVLTAHTEALLQKVVGNCRKLGAPKVFYIAADMASPEAPESVVQFALDKLGGLDYLVLNHIGGAPAGTRARSPQATRWLMQVNFVSYVQLTSRALPSLTDSKGSLVVVSSLLGRVPTSFSTPYSAAKFALDGFFGSLRRELDVQDVNVAITMCVLGLRDRASAAEAVRSSTSRPRQPEHRGVPLQSQTAMFLPPTVPGARTLTETPLRGWPQPKMKSSRQKSKTEKNDGHLEPVTAWEVQVPRVRRLCRGLARPHLFGHD
Tissue specificity：
Induction：
Developmental stage：
Protein families：Short-chain dehydrogenases/reductases (SDR) family