MCA3_HUMAN O43324
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O43324
Recommended name：Eukaryotic translation elongation factor 1 epsilon-1
EC number：
Alternative names：(Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3) (Elongation factor p18) (Multisynthase complex auxiliary component p18)
Cleaved into：
GeneID：9521
Gene names (primary )：EEF1E1
Gene names (synonym )：AIMP3 P18
Gene names (ORF )：
Length：174
Mass：19811
Sequence：MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
Tissue specificity：Down-regulated in various cancer tissues. {ECO:0000269|PubMed:15680327}.
Induction：By DNA damaging agents such as UV, adriamycin, actinomycin-D and cisplatin.
Developmental stage：
Protein families：