CLC2A_HUMAN Q6UVW9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6UVW9
Recommended name：C-type lectin domain family 2 member A
EC number：
Alternative names：(Keratinocyte-associated C-type lectin) (KACL) (Proliferation-induced lymphocyte-associated receptor) (PILAR)
Cleaved into：
GeneID：387836
Gene names (primary )：CLEC2A
Gene names (synonym )：KACL
Gene names (ORF )：UNQ5792/PRO19597
Length：174
Mass：19972
Sequence：MINPELRDGRADGFIHRIVPKLIQNWKIGLMCFLSIIITTVCIIMIATWSKHAKPVACSGDWLGVRDKCFYFSDDTRNWTASKIFCSLQKAELAQIDTQEDMEFLKRYAGTDMHWIGLSRKQGDSWKWTNGTTFNGWFEIIGNGSFAFLSADGVHSSRGFIDIKWICSKPKYFL
Tissue specificity：Mainly expressed in skin. Also expressed in keratinocytes, spleen, thymus, small intestine, peripheral blood monocytes, bone marrow, ovary, testis and skin. High expression in CD8(+), B-lymphocytes and naive CD4(+) T-cells. Restricted mostly to proliferating lymphocytes. Not detected in myeloid leukocytes or natural killer (NK) cells. {ECO:0000269|PubMed:18046548, ECO:0000269|PubMed:18550855, ECO:0000269|PubMed:20194751}.
Induction：By phytohemagglutinin (PHA) in peripheral CD8(+) T cells.
Developmental stage：
Protein families：