PDRG1_HUMAN Q9NUG6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NUG6
Recommended name:p53 and DNA damage-regulated protein 1
EC number:
Alternative names:
Cleaved into:
GeneID:81572
Gene names (primary ):PDRG1
Gene names (synonym ):C20orf126 PDRG
Gene names (ORF ):
Length:133
Mass:15511
Sequence:MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG
Tissue specificity:Predominantly expressed in normal testis and exhibits reduced but detectable expression in other organs. {ECO:0000269|PubMed:14562055}.
Induction:By UV irradiation and repressed by p53/TP53. {ECO:0000269|PubMed:14562055}.
Developmental stage:
Protein families:Prefoldin subunit beta family