PPARA_HUMAN Q07869
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q07869
Recommended name：Peroxisome proliferator-activated receptor alpha
EC number：
Alternative names：(PPAR-alpha) (Nuclear receptor subfamily 1 group C member 1)
Cleaved into：
GeneID：5465
Gene names (primary )：PPARA
Gene names (synonym )：NR1C1 PPAR
Gene names (ORF )：
Length：468
Mass：52225
Sequence：MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
Tissue specificity：Skeletal muscle, liver, heart and kidney. Expressed in monocytes (PubMed:28167758). {ECO:0000269|PubMed:28167758, ECO:0000269|PubMed:7981125, ECO:0000269|PubMed:8993548}.
Induction：Down-regulated by aging. {ECO:0000269|PubMed:28167758}.
Developmental stage：
Protein families：Nuclear hormone receptor family, NR1 subfamily