NEUR4_HUMAN Q8WWR8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8WWR8
Recommended name：Sialidase-4
EC number：EC:3.2.1.18
Alternative names：(N-acetyl-alpha-neuraminidase 4)
Cleaved into：
GeneID：129807
Gene names (primary )：NEU4
Gene names (synonym )：
Gene names (ORF )：LP5125
Length：484
Mass：51572
Sequence：MGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPDDSHAHRLVLRRGTLAGGSVRWGALHVLGTAALAEHRSMNPCPVHDAGTGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQLPSGRLLVPAYTYRVDRRECFGKICRTSPHSFAFYSDDHGRTWRCGGLVPNLRSGECQLAAVDGGQAGSFLYCNARSPLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSIVGFPAPAPNRPRDDSWSVGPGSPLQPPLLGPGVHEPPEEAAVDPRGGQVPGGPFSRLQPRGDGPRQPGPRPGVSGDVGSWTLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTEPWVIYEGPSGYSDLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNLGDKPRGCCWPS
Tissue specificity：[Isoform 1]: Predominant form in liver. Also expressed in brain, kidney and colon. {ECO:0000269|PubMed:14962670, ECO:0000269|PubMed:15847605}.; [Isoform 2]: Highly expressed in brain and at lower levels in kidney and liver. {ECO:0000269|PubMed:15847605}.
Induction：Down-regulated during monocyte to macrophage differentiation. {ECO:0000269|PubMed:15885103}.
Developmental stage：
Protein families：Glycosyl hydrolase 33 family