S2547_HUMAN   Q6Q0C1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6Q0C1

Recommended name:Solute carrier family 25 member 47

EC number:

Alternative names:(Hepatocellular carcinoma down-regulated mitochondrial carrier protein)

Cleaved into:

GeneID:283600

Gene names  (primary ):SLC25A47

Gene names  (synonym ):C14orf68 HDMCP

Gene names  (ORF ):HMFN1655

Length:308

Mass:33435

Sequence:MDFVAGAIGGVCGVAVGYPLDTVKVRIQTEPKYTGIWHCVRDTYHRERVWGFYRGLSLPVCTVSLVSSVSFGTYRHCLAHICRLRYGNPDAKPTKADITLSGCASGLVRVFLTSPTEVAKVRLQTQTQAQKQQRRLSASGPLAVPPMCPVPPACPEPKYRGPLHCLATVAREEGLCGLYKGSSALVLRDGHSFATYFLSYAVLCEWLSPAGHSRPDVPGVLVAGGCAGVLAWAVATPMDVIKSRLQADGQGQRRYRGLLHCMVTSVREEGPRVLFKGLVLNCCRAFPVNMVVFVAYEAVLRLARGLLT

Tissue specificity:Specifically expressed in liver. {ECO:0000269|PubMed:15322095}.

Induction:Down-regulated in hepatocarcinoma. {ECO:0000269|PubMed:15322095}.

Developmental stage:

Protein families:Mitochondrial carrier (TC 2.A.29) family


   💬 WhatsApp