S2547_HUMAN Q6Q0C1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6Q0C1
Recommended name：Solute carrier family 25 member 47
EC number：
Alternative names：(Hepatocellular carcinoma down-regulated mitochondrial carrier protein)
Cleaved into：
GeneID：283600
Gene names (primary )：SLC25A47
Gene names (synonym )：C14orf68 HDMCP
Gene names (ORF )：HMFN1655
Length：308
Mass：33435
Sequence：MDFVAGAIGGVCGVAVGYPLDTVKVRIQTEPKYTGIWHCVRDTYHRERVWGFYRGLSLPVCTVSLVSSVSFGTYRHCLAHICRLRYGNPDAKPTKADITLSGCASGLVRVFLTSPTEVAKVRLQTQTQAQKQQRRLSASGPLAVPPMCPVPPACPEPKYRGPLHCLATVAREEGLCGLYKGSSALVLRDGHSFATYFLSYAVLCEWLSPAGHSRPDVPGVLVAGGCAGVLAWAVATPMDVIKSRLQADGQGQRRYRGLLHCMVTSVREEGPRVLFKGLVLNCCRAFPVNMVVFVAYEAVLRLARGLLT
Tissue specificity：Specifically expressed in liver. {ECO:0000269|PubMed:15322095}.
Induction：Down-regulated in hepatocarcinoma. {ECO:0000269|PubMed:15322095}.
Developmental stage：
Protein families：Mitochondrial carrier (TC 2.A.29) family