SIA7F_HUMAN Q969X2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q969X2
Recommended name：Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
EC number：EC:2.4.99.-
Alternative names：(GalNAc alpha-2,6-sialyltransferase VI) (ST6GalNAc VI) (ST6GalNAcVI) (hST6GalNAc VI) (Sialyltransferase 7F) (SIAT7-F)
Cleaved into：
GeneID：30815
Gene names (primary )：ST6GALNAC6
Gene names (synonym )：SIAT7F
Gene names (ORF )：UNQ708/PRO1359
Length：333
Mass：38068
Sequence：MACSRPPSQCEPTSLPPGPPAGRRHLPLSRRRREMSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT
Tissue specificity：Expressed in kidney, in proximal tubule epithelial cells. Expressed in colon cell lines. {ECO:0000269|PubMed:12668675, ECO:0000269|PubMed:17123352}.
Induction：Down-regulated in renal cancers.
Developmental stage：
Protein families：Glycosyltransferase 29 family