TISB_HUMAN Q07352
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q07352
Recommended name：mRNA decay activator protein ZFP36L1
EC number：
Alternative names：(Butyrate response factor 1) (EGF-response factor 1) (ERF-1) (TPA-induced sequence 11b) (Zinc finger protein 36, C3H1 type-like 1) (ZFP36-like 1)
Cleaved into：
GeneID：677
Gene names (primary )：ZFP36L1
Gene names (synonym )：BERG36 BRF1 ERF1 RNF162B TIS11B
Gene names (ORF )：
Length：338
Mass：36314
Sequence：MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELCRPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD
Tissue specificity：Expressed mainly in the basal epidermal layer, weakly in the suprabasal epidermal layers (PubMed:27182009). Expressed in epidermal keratinocytes (at protein level) (PubMed:27182009). Expressed in osteoblasts (PubMed:15465005). {ECO:0000269|PubMed:15465005, ECO:0000269|PubMed:27182009}.
Induction：Down-regulated under hypoxic conditions in endothelial cells (at protein level) (PubMed:21832157). Up-regulated by growth factor (TGF-beta), cytokines, tumor necrosis factor (TNF-alpha) and epidermal growth factor (EGF) in keratinocytes (PubMed:20166898). Up-regulated also by glucocorticoid dexamethasone in keratinocytes (PubMed:20166898). Up-regulated in keratinocytes in response to wounding in a p38 MAPK-dependent manner (PubMed:20166898, PubMed:27182009). Up-regulated by the parathyroid hormone (PTH) in osteoblast-like cells in a cAMP/PKA-dependent manner (PubMed:15465005, PubMed:19179481). Up-regulated in response to adrenocorticotropic hormone (ACTH) (PubMed:19179481). Up-regulated during monocyte/macrophage differentiation in response to phorbol ester 12-O-tetradecanoylphorbol-13-acetate (TPA) (PubMed:26542173). Down-regulated by butyrate in colorectal cancer cells (PubMed:10367403). {ECO:0000269|PubMed:10367403, ECO:0000269|PubMed:15465005, ECO:0000269|PubMed:19179481, ECO:0000269|PubMed:20166898, ECO:0000269|PubMed:21832157, ECO:0000269|PubMed:26542173, ECO:0000269|PubMed:27182009}.
Developmental stage：
Protein families：