S35C2_HUMAN Q9NQQ7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NQQ7
Recommended name:Solute carrier family 35 member C2
EC number:
Alternative names:(Ovarian cancer-overexpressed gene 1 protein)
Cleaved into:
GeneID:51006
Gene names (primary ):SLC35C2
Gene names (synonym ):C20orf5 OVCOV1
Gene names (ORF ):CGI-15
Length:365
Mass:40432
Sequence:MGRWALDVAFLWKAVLTLGLVLLYYCFSIGITFYNKWLTKSFHFPLFMTMLHLAVIFLFSALSRALVQCSSHRARVVLSWADYLRRVAPTALATALDVGLSNWSFLYVTVSLYTMTKSSAVLFILIFSLIFKLEELRAALVLVVLLIAGGLFMFTYKSTQFNVEGFALVLGASFIGGIRWTLTQMLLQKAELGLQNPIDTMFHLQPLMFLGLFPLFAVFEGLHLSTSEKIFRFQDTGLLLRVLGSLFLGGILAFGLGFSEFLLVSRTSSLTLSIAGIFKEVCTLLLAAHLLGDQISLLNWLGFALCLSGISLHVALKALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQGQQ
Tissue specificity:Ubiquitously expressed although the level of expression is tissue dependent. Overexpressed in ovarian cancer.
Induction:In hypoxic trophoblast cells.
Developmental stage:
Protein families:TPT transporter family, SLC35C subfamily