AGR3_HUMAN Q8TD06
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8TD06
Recommended name：Anterior gradient protein 3
EC number：
Alternative names：(AG-3) (AG3) (hAG-3) (Anterior gradient 3 homolog) (Breast cancer membrane protein 11) (Protein disulfide isomerase family A, member 18)
Cleaved into：
GeneID：155465
Gene names (primary )：AGR3
Gene names (synonym )：BCMP11 PDIA18
Gene names (ORF )：UNQ642/PRO1272
Length：166
Mass：19171
Sequence：MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL
Tissue specificity：Expressed in the lung, in the ciliated cells of the airway epithelium (PubMed:25751668). Expression increased with differentiation of airway epithelial cells (PubMed:25751668). Not detected in the mucous cells (PubMed:25751668). Expressed in ciliated cells in the oviduct (PubMed:26170690). Also detected in stomach, colon, prostate and liver (PubMed:25751668). Expressed in breast, ovary, prostate and liver cancer (PubMed:26170690). Expression is associated with the level of differentiation of breast cancer (at protein level) (PubMed:26170690). {ECO:0000269|PubMed:25751668, ECO:0000269|PubMed:26170690}.
Induction：Not induced as part of the cellular response to endoplasmic reticulum stress (PubMed:25751668). Up-regulated by androgens and by estrogens in prostate cancer cells (PubMed:23294566) Up-regulated by a hormone (estrogen-receptor alpha) independent mechanism in ovarian cancer (PubMed:22361111). {ECO:0000269|PubMed:22361111, ECO:0000269|PubMed:23294566, ECO:0000269|PubMed:25751668}.
Developmental stage：
Protein families：AGR family