CDNF_HUMAN Q49AH0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q49AH0
Recommended name：Cerebral dopamine neurotrophic factor
EC number：
Alternative names：(ARMET-like protein 1) (Conserved dopamine neurotrophic factor)
Cleaved into：
GeneID：441549
Gene names (primary )：CDNF
Gene names (synonym )：ARMETL1
Gene names (ORF )：
Length：187
Mass：20964
Sequence：MWCASPVAVVAFCAGLLVSHPVLTQGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL
Tissue specificity：Widely expressed in neuronal and non-neuronal tissues. In the brain, highest levels in the optic nerve and corpus callosum. {ECO:0000269|PubMed:17611540}.
Induction：Not induced by endoplasmic reticulum stress. {ECO:0000269|PubMed:18561914}.
Developmental stage：
Protein families：ARMET family