SAT2_HUMAN Q96F10
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96F10
Recommended name：Thialysine N-epsilon-acetyltransferase
EC number：EC:2.3.1.-
Alternative names：(Diamine acetyltransferase 2) (Spermidine/spermine N(1)-acetyltransferase 2) (SSAT-2)
Cleaved into：
GeneID：112483
Gene names (primary )：SAT2
Gene names (synonym )：SSAT2
Gene names (ORF )：
Length：170
Mass：19155
Sequence：MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAGK
Tissue specificity：Widely expressed (PubMed:15283699, PubMed:12803540). Under physiological conditions, SSAT2 is expressed at lower level that SSAT1 (SSAT). Many tissues express only SSAT1, several tissues express both SSAT1 and SSAT2, and bone, cervix, ovary and pineal gland expressed only SSAT2 (PubMed:12803540). {ECO:0000269|PubMed:12803540, ECO:0000269|PubMed:15283699}.
Induction：Not inducible by polyamine analogs. {ECO:0000269|PubMed:12803540}.
Developmental stage：
Protein families：Acetyltransferase family