I27L1_HUMAN Q96BM0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96BM0
Recommended name：Interferon alpha-inducible protein 27-like protein 1
EC number：
Alternative names：(Interferon-stimulated gene 12c protein) (ISG12(c)) (ISG12C)
Cleaved into：
GeneID：122509
Gene names (primary )：IFI27L1
Gene names (synonym )：FAM14B
Gene names (ORF )：
Length：104
Mass：9549
Sequence：MGKESGWDSGRAAVAAVVGGVVAVGTVLVALSAMGFTSVGIAASSIAAKMMSTAAIANGGGVAAGSLVAILQSVGAAGLSVTSKVIGGFAGTALGAWLGSPPSS
Tissue specificity：
Induction：Not up-regulated by type-I interferon. {ECO:0000269|PubMed:14728724, ECO:0000269|PubMed:27777077}.
Developmental stage：
Protein families：IFI6/IFI27 family