LIMD2_HUMAN   Q9BT23


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BT23

Recommended name:LIM domain-containing protein 2

EC number:

Alternative names:

Cleaved into:

GeneID:80774

Gene names  (primary ):LIMD2

Gene names  (synonym ):

Gene names  (ORF ):SB143

Length:127

Mass:14070

Sequence:MFQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWAHKEVDPGTKTA

Tissue specificity:

Induction:Over-expressed in breast, bladder, melanoma and thyroid cancer cell lines and tumors (at protein level). {ECO:0000269|PubMed:24590809}.

Developmental stage:

Protein families:


   💬 WhatsApp