MP2K6_HUMAN P52564
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P52564
Recommended name：Dual specificity mitogen-activated protein kinase kinase 6
EC number：EC:2.7.12.2
Alternative names：(MAP kinase kinase 6) (MAPKK 6) (MAPK/ERK kinase 6) (MEK 6) (Stress-activated protein kinase kinase 3) (SAPK kinase 3) (SAPKK-3) (SAPKK3)
Cleaved into：
GeneID：5608
Gene names (primary )：MAP2K6
Gene names (synonym )：MEK6 MKK6 PRKMK6 SKK3
Gene names (ORF )：
Length：334
Mass：37492
Sequence：MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
Tissue specificity：Isoform 2 is only expressed in skeletal muscle. Isoform 1 is expressed in skeletal muscle, heart, and in lesser extent in liver or pancreas. {ECO:0000269|PubMed:8621675}.
Induction：Strongly activated by UV, anisomycin, and osmotic shock but not by phorbol esters, NGF or EGF.
Developmental stage：
Protein families：Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase subfamily